SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL007C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL007C
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.14e-29
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 2 Region: 261-346
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 3.14e-21
Family HSP40/DnaJ peptide-binding domain 0.00000337
Further Details:      
 
Domain Number 3 Region: 182-259
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000000000536
Family HSP40/DnaJ peptide-binding domain 0.00000557
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL007C
Sequence length 352
Comment SIS1 ORF Verified Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; not functionally redundant with Ydj1p due to due to substrate specificity; shares similarity with bacterial DnaJ proteins
Sequence
MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK
REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNIFSQFFG
GSSPFGGADDSGFSFSSYPSGGGAGMGGMPGGMGGMHGGMGGMPGGFRSASSSPTYPEEE
TVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQGDYN
PQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPLSRV
QPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF
Download sequence
Identical sequences N1NY39 P25294
YNL007C 4932.YNL007C YNL007C YNL007C NP_014391.1.97178 YNL007C YNL007C APC90055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]