SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL064C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL064C
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.01e-34
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 140-210
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 7.19e-19
Family DnaJ/Hsp40 cysteine-rich domain 0.00000671
Further Details:      
 
Domain Number 3 Region: 259-344
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.05e-18
Family HSP40/DnaJ peptide-binding domain 0.00000699
Further Details:      
 
Domain Number 4 Region: 115-148,214-257
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 1.96e-16
Family HSP40/DnaJ peptide-binding domain 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL064C
Sequence length 409
Comment YDJ1 ORF Verified Protein chaperone involved in regulation of the HSP90 and HSP70 functions; involved in protein translocation across membranes; member of the DnaJ family
Sequence
MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDP
EKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEI
SASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQR
FQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAP
DVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPG
EVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPA
IPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ
Download sequence
Identical sequences P25491
YNL064C NP_014335.1.97178 YNL064C YNL064C APC90056 YNL064C YNL064C 4932.YNL064C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]