SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL077W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL077W
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.36e-25
Family Chaperone J-domain 0.00032
Further Details:      
 
Domain Number 2 Region: 203-272
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.000000000000432
Family DnaJ/Hsp40 cysteine-rich domain 0.00049
Further Details:      
 
Domain Number 3 Region: 177-211,275-319
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000131
Family HSP40/DnaJ peptide-binding domain 0.0025
Further Details:      
 
Domain Number 4 Region: 339-419
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.0000000249
Family HSP40/DnaJ peptide-binding domain 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL077W
Sequence length 528
Comment APJ1 ORF Verified Putative chaperone of the HSP40 (DNAJ) family; overexpression interferes with propagation of the [Psi+] prion; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKD
NRLRALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSNFDTEAMSFPDLSPGDLFAQFFN
SSATPSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIK
HNLKCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKKCTCKTCKGQGIQTQTRRMGPLVQ
SWSQTCADCGGAGVFVKNKDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVLTGEGDEV
ISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGVVYIEGHP
SGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPERLEPENAK
KIQNILANDKYIKAERSTMETADSDCYCDLEKSYDSVEEHVLSSFEAPNLNNEVIEDDDL
GDLINERDSRKRNNRRFDESNINNNNETKRNKYSSPVSGFYDHNINGY
Download sequence
Identical sequences YNL077W YNL077W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]