SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL085W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL085W
Domain Number 1 Region: 3-109,148-246
Classification Level Classification E-value
Superfamily PIN domain-like 5.1e-31
Family 5' to 3' exonuclease catalytic domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL085W
Sequence length 830
Comment MKT1 ORF Verified Protein that forms a complex with Pbp1p that may mediate posttranscriptional regulation of HO; involved in propagation of M2 dsRNA satellite of L-A virus; allelic variation affects mitochondrial genome stability, drug resistance, and more
Sequence
MAIKSLESFLFERGLVGSYAIEALNNCTLGIDVNHYVSRLLTNKREQYLDAIGGFPTSLK
MYLESDLKIFKDFNITPIFVFNGGLTYNQLEASGHFTAASASASISSTTTSSSGTNATTR
SNTESVLLQRSRGWTQWNNLISSNQNSYIDQPIQPQEPFRHNTTIDSKAYQNDLIAYFIE
HGYMYQVAPYSSWFQLAYLLNSAYIDAIYGPTDCLMLDCVDRFILGMEFPNKEFRFIDRS
RVMKDLGCTHEEFIDIAMAVGNDLQPTTLPPLQIYPVPQLFDIALEMVLNTGTNFYAYQL
STTLQNDSKENIQNYQRGISALRYMPVLKDTGKVELFVQEIVVSEEDSEKNNKDGKKSNL
SSPSSASSSASPATTVTKNASEKLTYEKSSTKEVRKPRDIPNDVHDFIGQMLPHEYYFYR
SIGLVTGKLFDAIVTGVYPEEPPLGGGSSTSYRKLVSKSVEIFKNKEINLLTQPINRYYQ
IKQIKQVKWYAANEPTTLTNRMSPSMFETINHLIVKTETSDEKEFSISEFITTINGSSNM
AKDFISEKVIFPNSVPIESKLNSPFNLLSTNFLRLLVLLEFFTFDFKEKLLEPTRWGEVF
LKLNELNIDSKYHESVIIFLVFLKCDVLKLDEEVQPPAPSALSQATLRSYPEESLYVLLI
TRVLTLFQVDQKPSNYHGPIDKKTLIFRDHLSFIKENLNELFEAVLISSLTSGEFNRLSL
DNFGWARKIVRYLPFKLDSPNTIMAMMWEFFLQKYLHNGNAKNDALSLVATEFNTYKSTP
NLDEQFVESHRFLLEISKVMQELNAAKLIDENVFKLFTKAVEFTTTALSS
Download sequence
Identical sequences A6ZRZ5 B3LNU4 C8ZGE5 H0GMK6 N1NXY4
tr|A6ZRZ5|A6ZRZ5_YEAS7 YNL085W YNL085W SCRT_03222 YNL085W YNL085W YNL085W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]