SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL227C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL227C
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Chaperone J-domain 5.89e-26
Family Chaperone J-domain 0.00029
Further Details:      
 
Domain Number 2 Region: 332-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000462
Family Classic zinc finger, C2H2 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL227C
Sequence length 496
Comment JJJ1 ORF Verified Co-chaperone that stimulates the ATPase activity of Ssa1p, required for a late step of ribosome biogenesis; associated with the cytosolic large ribosomal subunit; contains a J-domain; mutation causes defects in fluid-phase endocytosis
Sequence
MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDP
QERAWYDSHKEQILNDTPPSTDDYYDYEVDATVTGVTTDELLLFFNSALYTKIDNSAAGI
YQIAGKIFAKLAKDEILSGKRLGKFSEYQDDVFEQDINSIGYLKACDNFINKTDKLLYPL
FGYSPTDYEYLKHFYKTWSAFNTLKSFSWKDEYMYSKNYDRRTKREVNRRNEKARQQARN
EYNKTVKRFVVFIKKLDKRMKEGAKIAEEQRKLKEQQRKNELNNRRKFGNDNNDEEKFHL
QSWQTVKEENWDELEKVYDNFGEFENSKNDKEGEVLIYECFICNKTFKSEKQLKNHINTK
LHKKNMEEIRKEMEEENITLGLDNLSDLEKFDSADESVKEKEDIDLQALQAELAEIERKL
AESSSEDESEDDNLNIEMDIEVEDVSSDENVHVNTKNKKKRKRKKKQRLTQKQRNLNRSM
ILKTNGVMSWMIFWHH
Download sequence
Identical sequences YNL227C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]