SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR288C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR288C
Domain Number 1 Region: 24-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.27e-27
Family PDI-like 0.012
Further Details:      
 
Weak hits

Sequence:  YOR288C
Domain Number - Region: 165-211,243-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0176
Family Thioltransferase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOR288C
Sequence length 318
Comment MPD1 ORF Verified Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation
Sequence
MLFLNIIKLLLGLFIMNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCG
HCKKLSSTFRKAAKRLDGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKP
IDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVL
FSKQDKISPVYKSIALDWLGKFDFYSISNKKLKQLTDMNPTYEKTPEIFKYLQKVIPEQR
QSDKSKLVVFDADKDKFWEYEGNSINKNDISKFLRDTFSITPNEGPFSRRSEYIAYLKTG
KKPIKKNHSSSGNKHDEL
Download sequence
Identical sequences A0A0L8VGY0 C7GWA4 C8ZH38 E7KUM8 E7QL10 H0GNZ1 N1NXD6 Q12404
YOR288C YOR288C YOR288C YOR288C YOR288C YOR288C 4932.YOR288C NYSGXRC-T633 YOR288C NP_014931.3.97178 YOR288C YOR288C YOR288C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]