SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR324C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR324C
Domain Number - Region: 518-567
Classification Level Classification E-value
Superfamily Prefoldin 0.0732
Family Prefoldin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOR324C
Sequence length 602
Comment FRT1 ORF Verified Tail-anchored ER membrane protein that is a substrate of the phosphatase calcineurin; interacts with homolog Frt2p; promotes cell growth in stress conditions, possibly via a role in posttranslational translocation
Sequence
MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTN
VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQKEREKEKEEQPALHDRRHLYVTKN
RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP
KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQIQGSSSSQRRSSAGSFDYERKRLV
NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMHSQSQISVNSSPSTSLFYHDLDG
SAVNDSSSFLYSRSNVPAFLSSSAFSSTSSTSSDSEDVDRRSLNGVYPSLGYLTNQRKPR
NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATPDSSSNSISKSNS
NLNDNIDELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLL
DEMTTLRTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN
KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYVKNLLTRFF
TR
Download sequence
Identical sequences N1P3T7 Q99332
NP_014969.3.97178 YOR324C YOR324C YOR324C 4932.YOR324C YOR324C YOR324C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]