SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL059W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL059W
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.64e-31
Family Thioltransferase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YPL059W
Sequence length 150
Comment GRX5 ORF Verified Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; mitochondrial matrix protein involved in the synthesis/assembly of iron-sulfur centers; monothiol glutaredoxin subfamily member along with Grx3p and Grx4p
Sequence
MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRKAIEDAIESAPVVLFMKGTPEFPKC
GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI
TSMARSGELADLLEEAQALVPEEEEETKDR
Download sequence
Identical sequences A0A250WDC6 C7GTZ7 G2WPC0 N1NVH8 Q02784
YPL059W YPL059W YPL059W YPL059W 4932.YPL059W YPL059W YPL059W YPL059W APC7705 GRX5_YEAST NYSGXRC-P107 NP_015266.1.97178 YPL059W YPL059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]