SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR037C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR037C
Domain Number 1 Region: 112-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.33e-50
Family Glutathione peroxidase-like 0.0000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR037C
Sequence length 295
Comment SCO1 ORF Verified Copper-binding protein of the mitochondrial inner membrane, required for cytochrome c oxidase activity and respiration; may function to deliver copper to cytochrome c oxidase; has similarity to thioredoxins
Sequence
MLKLSRSANLRLVQLPAARLSGNGAKLLTQRGFFTVTRLWQSNGKKPLSRVPVGGTPIKD
NGKVREGSIEFSTGKAIALFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFH
LEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFIT
CDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPPNVKPGQDYLVDHS
IFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQRAKQKEAWYSFLFK
Download sequence
Identical sequences A6ZKY1 B5VE03 C7GXX5 D3UED3 E7K9R6 E7QBE9 N1P800 P23833
YBR037C YBR037C YBR037C YBR037C YBR037C YBR037C YBR037C YBR037C 4932.YBR037C YBR037C NP_009593.1.97178 YBR037C YBR037c___KOG2792 YBR037C tr|A6ZKY1|A6ZKY1_YEAS7 YBR037C YBR037C YT155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]