SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL010W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL010W
Domain Number 1 Region: 61-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.49e-32
Family Glutathione peroxidase-like 0.000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIL010W
Sequence length 215
Comment DOT5 ORF Verified Nuclear thiol peroxidase which functions as an alkyl-hydroperoxide reductase during post-diauxic growth
Sequence
MGEALRRSTRIAISKRMLEEEESKLAPISTPEVPKKKIKTGPKHNANQAVVQEANRSSDV
NELEIGDPIPDLSLLNEDNDSISLKKITENNRVVVFFVYPRASTPGCTRQACGFRDNYQE
LKKYAAVFGLSADSVTSQKKFQSKQNLPYHLLSDPKREFIGLLGAKKTPLSGSIRSHFIF
VDGKLKFKRVKISPEVSVNDAKKEVLEVAEKFKEE
Download sequence
Identical sequences N1P967 P40553
NP_012255.3.97178 XP_015332418.1.40921 YIL010W 4932.YIL010W YIL010W YIL010W YIL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]