SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL151C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL151C
Domain Number 1 Region: 206-558,629-802
Classification Level Classification E-value
Superfamily TPR-like 1.1e-49
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  YIL151C
Domain Number - Region: 948-1011,1038-1099
Classification Level Classification E-value
Superfamily PIN domain-like 0.00471
Family PIN domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YIL151C
Sequence length 1118
Comment ORF Uncharacterized Putative protein of unknown function, predicted to contain a PINc domain
Sequence
MVDLMVPANDDPSNETDYSRSNNNHTHIVSDMRPTSAAFLHQKRHSSSSHNDTPESSFAK
RRVPGIVDPVGKGFIDGITNSQISAQNTPSKTDDASRRPSISRKVMESTPQVKTSSIPTM
DVPKSPYYVNRTMLARNMKVVSRDTYEDNANPQMRADEPLVASNGIYSNSQPQSQVTLSD
IRRAPVVAASPPPMIRQLPSAQPNQTFIKKLQEIYKIIVVQETELQQRCLYLTTSQTTEL
KSLWAIYRLNTELIKNYINFIITALLTTQPINDLIMGQEILDIYRIEKRLWVYGIITFLD
VLKNFSNFMDPEVCCQFIIYAFISVSNMLEDIPLKYSILWRQRLGDLSRMAISLYPSGFI
DWRLSAEYWYTESMKYIYGCGKLYYHIATVQQNSLEAFVNLGKSVFCQDPFTPSQQTLQL
LIENIYQSAFIDRSSGSANNNEIAHRNSQLIDYLKHTEVMLLPSFLENMDLQHVVLMYFK
DKFGKDFNGNDVFDTKDMFCQNPESLRYYFRHAPAFAESQLLQLIGFGNPKNPFALLFQL
PKYLKLKKDKREKKRSEATETSSYTDPFDVQISSESYFQNIDALNSSFNDIPTNLNIWLD
SLNHINMTSIQCSIHVLTKFLHAPLVVALPHFLTWLHFIVAILKKLEMVNSKQVVAFWIH
FLRRTMPWNSIVTLGNVLVCYMLDNLHPFLKKELEKFYSLELDDLIEYYNENENLPEIWK
CWGTLWFDAIKKCDVMEIPGVQDHLFFDSPLDGIVFDEKDEVGEKFWMRSVRAVLLLKGI
AKKFPDLGLKVSFQASVFCRRNDIPPDYFLKNLTFKLDAYDEDNYNDNNELDDLYDTIEI
NEEIEAVNMDPQATPNLSVVSGESIFEYTGYTRLAPDYHCFDKNGGFNSAFIYSQWSNVG
NGVTLDVSGESIYDVANNNLSLHWEKIFFDKIAAASKGSDENYNCTLYFVIDATSWLRHF
AHIFKLAKNNTLKFAICLTTFQELRYLRGSKDDTVVEAATRSVITIRQLYDEKKIIPMRF
TGNIATHVEENLEFEEQITWKTHVDEFVIDAIAKLNQRFQAERLTDENKNKGKEFAVLVT
DDDNMNQKAKDRMIKTCNTKYLFSLGSKLGINSGLCTN
Download sequence
Identical sequences P40456
YIL151C 4932.YIL151C NP_012115.1.97178 YIL151C YIL151C YIL151C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]