SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR090W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR090W
Domain Number 1 Region: 10-109
Classification Level Classification E-value
Superfamily Chaperone J-domain 9.16e-29
Family Chaperone J-domain 0.00031
Further Details:      
 
Domain Number 2 Region: 301-386
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.00000000000000157
Family HSP40/DnaJ peptide-binding domain 0.0019
Further Details:      
 
Domain Number 3 Region: 146-238
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.0000000000301
Family DnaJ/Hsp40 cysteine-rich domain 0.002
Further Details:      
 
Domain Number 4 Region: 131-164,241-282
Classification Level Classification E-value
Superfamily HSP40/DnaJ peptide-binding domain 0.000000000406
Family HSP40/DnaJ peptide-binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YLR090W
Sequence length 459
Comment XDJ1 ORF Verified Putative chaperone, homolog of E. coli DnaJ, closely related to Ydj1p; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MSGSDRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAA
YEILSDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFPGEYEA
YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTHDVE
CESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSKK
EIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTEKQENLEQKQIFLKNFDDGA
GEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPILDN
PHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTNNET
ISNFRIIHTDDLPEGIRPFKPEAQDSAYQKARSSYCCIQ
Download sequence
Identical sequences A0A250WLR6 G2WIT2 N1P130
YLR090W YLR090W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]