SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL153C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL153C
Domain Number 1 Region: 19-120
Classification Level Classification E-value
Superfamily Prefoldin 1.88e-16
Family Prefoldin 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YNL153C
Sequence length 129
Comment GIM3 ORF Verified Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it
Sequence
MELLPQGQRNNTQVTFEDQQKINEFSKLIMRKDAIAQELSLQREEKEYLDDVSLEIELID
EDEPVQYKVGDLFIFMKQSKVTAQLEKDAERLDNKIETLEDKQRDIDSRLDALKAILYAK
FGDNINLER
Download sequence
Identical sequences A0A0L8VIF6 B3LP08 C7GXV3 E7KH19 E7QJV6 N1NXT5 P53900
4932.YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C YNL153c___KOG1760 YNL153C YNL153C YNL153C YNL153C YNL153C YNL153C APC5966 YNL153C NP_014246.1.97178 YNL153C YNL153C SCRT_03287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]