SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR051C from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YOR051C
Domain Number - Region: 273-311,338-390
Classification Level Classification E-value
Superfamily TPR-like 0.0569
Family Tetratricopeptide repeat (TPR) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOR051C
Sequence length 412
Comment ETT1 ORF Verified Nuclear protein that inhibits replication of Brome mosaic virus in S. cerevisiae, which is a model system for studying replication of positive-strand RNA viruses in their natural hosts; deletion increases stop codon readthrough
Sequence
MAKRPLGLGKQSREKKRKVESVEKKSDEPSRESTPVRSQMSVELDDDADLDDELAQLKGL
WSKYFHSDRDDEYVLNGIVHECDRLLRLSEEDKEIKKTLNDIFHGIYALALSELTIFKAG
DEEATEEKRKKDVSSFFESAIERVELGLSHFPESQFLKLVLAKIIFQRIPLEYISNLHLK
SKDKKLDLVGQLEHGKKHFSIYENDTEFTFEILQMVNDLLDIVENFGREQSIQEGIDSDN
EEEEELIDIELEPEHPVYPLQQSLEANYEWLRNHFDKLLDNTNTDVKIYASIANTLGELY
LKKAEEPSKVFLSLQYDDGGSEKVSDKEAKNAQETALKHTKKALEYLEKAKLEDDPDTWV
QVAEAYIDLGNLLDNESAEQEEAYKTAEEILGKANKASHGKFQDVLDNFLQG
Download sequence
Identical sequences C7GLH8 N1P300 Q08421
YOR051C YOR051C YOR051C YOR051C YOR051C 4932.YOR051C YOR051C NP_014694.1.97178 YOR051C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]