SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR089W from Saccharomyces cerevisiae W303

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR089W
Domain Number 1 Region: 68-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000464
Family Ankyrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR089W
Sequence length 888
Comment ORF Uncharacterized Protein of unknown function; exhibits genetic interaction with ERG11 and protein-protein interaction with Hsp82p
Sequence
MNSVWDDARIEDRTVDKPVGSSHAQEKLALVKSTLFKLDQEDRPECDSWVQLVKLICDED
REEEFTTFKELLREVKNVNDKSVTGVALIHYIIVFDRADYIELLHDNPSGAKLDLNLVDD
IVGYTPLMWSFSLQRRNCCLELFNAFDEINFNMTNKAGLTAWDMVPPYSPLSEFLEQNNM
FRYRTEVKHEIPQISQPKDTSLLMSNEDSTTKETFDNIDLQVAGLTLSPGANDNMFLDSD
EKNMNHSQGAATLIDPTYTEDYHGTFDYDKLSPDQYLEFSDFDIPQILNLLISLPQKEPH
MTTYPAGLIYQCIRYADHKIKSKPLVESLINLSLTKILTSVSSNGAAGLVSTEASLQAGD
IVLQSYWLSCLSFLYYYLCRDDSFFKRHPSVLQELINTIHSIIIELTSSIHCRLISLIDS
TLLAYTTIQDVKQTLYKRDWNFFKKRKQAKLLLKEKNRKQLKEQQKKELHRKSQGQENHE
EEEGQQDGNDSDDRASTNDDNNSSVSLFYDKEILRHLYPPSFEEQMKPSPLKIVQIFGAL
SYVLNLHQTHPIFQQQCLSISVNWFATTLFNKILKDKKKRSLSRAHAIQIRLNLSTLESW
IQNNDFCVPKPMLIDDFMWQRFPMTLIRDVGEIDLSDPILRNVATYKPIDENNKDLIYDT
SNSLFYYQPFHKIAQIHLEPVFQLLQWLQVATTLDSEESLISTMNLLPRITPVQLLKSME
KYNYELNENKFNSKLKKFLNNKIKDSKMSKADAYLQEHEIPYLVLPTIPEMTDLYSKGPD
SHSFQPFLPGSIQDDVYEIHDVNFKQRQNEPQISRTNSGTSDFTGDEDKAQYETEGVGES
IDINETVEPESNAFNVGNDDYFKELNIPSSTAQRPAWSNNDDMEQNPW
Download sequence
Identical sequences A0A0L8VGX5 A6ZWX3 B3LK57 N1NVK7 O13585
SCRT_02570 tr|A6ZWX3|A6ZWX3_YEAS7 YPR089W 4932.YPR089W YPR089W NP_015414.2.97178 YPR089W YPR089W YPR089W YPR089W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]