SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR273C from Saccharomyces cerevisiae Vin13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR273C
Domain Number 1 Region: 165-293
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.68e-18
Family UBX domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR273C
Sequence length 436
Comment UBX7 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p
Sequence
MLEALFRDSVEEAINDSIKQGVVLAVYNTARDDQWLKSWFKGDDVSLDTLAEHSIWLRLV
KDTEQFQLFEQVFPNVVVPSIYLIRAGKIELIIQGEDDRHWEKLLTCIGIKDKKAGESSS
RETNPGLAREEKSSRDVHRKNARERIAETTLEIQRREQLKQRKLAEEERERIIRLVRADR
AERKALDETHHRTLDDDKPLDVHDYIKDAQKLHSSKCVLQIRMTDGKTLKHEFNSSETLN
DVRKWVDLNRTDGDCPYSFHRGIPRVTFKDSDELKTLETLELTPRSALLLKPLETQNSGL
SVTGMEGPSLLGRLYKGFSTWWRNDKDPEVTSQREETSKPNRHEVRSSTPLSGAASSSCF
QYNNVREPVQSSAHASPMLTPSGTRYPSETNLTTSRSVSPNVFQFVNNDHQEDPEDPTTF
NGNNVHLEKKKDEDKE
Download sequence
Identical sequences A0A0L8VUU8 A6ZLL2 C7GMV8 D3UF21 E7K9L9 E7KKN8 E7LRS1 E7Q167
YBR273C YBR273C YBR273C YBR273C YBR273C YBR273C YBR273C tr|A6ZLL2|A6ZLL2_YEAS7 YBR273C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]