SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL063C from Saccharomyces cerevisiae Vin13

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL063C
Domain Number 1 Region: 197-323
Classification Level Classification E-value
Superfamily PH domain-like 8.46e-35
Family Ran-binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIL063C
Sequence length 327
Comment YRB2 ORF Verified Protein of unknown function involved in nuclear processes of the Ran-GTPase cycle; involved in nuclear protein export; contains Ran Binding Domain and FxFG repeats; interacts with Srm1p, GTP-Gsp1p, Rna1p and Crm1p; is not essential
Sequence
MSETNGGNAARENSEVKQTAVENPIDKLDGTPKRPREKDQDEQAEETSDKSEAPNKNDEE
KKEEGKKDQEPSHKKIKVDDGKTVESGSVEDDKKEDKFVFGAASKFGTGFGVAKKDTKDG
DATTSTESLPASDSKTKKPFAFGSGLSFGSGFNILKNKTEDNSESEKKATDADKDKVHSG
SEQLANASEDTKDKPKPLKLQKQEVKSGEESEECIYQVNAKLYQLSNIKEGWKERGVGII
KINKSKDDVEKTRIVMRSRGILKVILNIQLVKGFTVQKGFTGSLQSEKFIRLLAVDDNGD
PAQYAIKTGKKETTDELYNIIVKSVPK
Download sequence
Identical sequences A0A0L8VNM1 B3LTR6 C8ZAI5 E7KDN8 E7KPV4 E7LVT7 E7QG42 H0GHX4 N1P101
YIL063C SCRT_05240 YIL063C YIL063C YIL063C YIL063C YIL063C YIL063C YIL063C YIL063C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]