SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL050W from Saccharomyces cerevisiae Y10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL050W
Domain Number 1 Region: 2-290
Classification Level Classification E-value
Superfamily TPR-like 3.32e-74
Family Tetratricopeptide repeat (TPR) 0.0000000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBL050W
Sequence length 292
Comment SEC17 ORF Verified Peripheral membrane protein required for vesicular transport between ER and Golgi, the 'priming' step in homotypic vacuole fusion, and autophagy; stimulates the ATPase activity of Sec18p; has similarity to mammalian alpha-SNAP
Sequence
MSDPVELLKRAEKKGVPSSGFMKLFSGSDSYKFEEAADLCVQAATIYRLRKELNLAGDSF
LKAADYQKKAGNEDEAGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFK
FELGEILENDLHDYAKAIDCYELAGEWYAQDQSVALSNKCFIKCADLKALDGQYIEASDI
YSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADSRESNF
LKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIKESIQQQEDDLL
Download sequence
Identical sequences A6ZKP8 B3LNI7 C8Z3P9 G2W8V8 N1PAX3 P32602
tr|A6ZKP8|A6ZKP8_YEAS7 YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W NP_009503.1.97178 4932.YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W YBL050W SCRT_03014 YBL050W YBL050W YBL050W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]