SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR513W from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR513W
Domain Number 1 Region: 42-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.1e-23
Family Thioltransferase 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR513W
Sequence length 143
Comment GRX2 ORF Verified Cytoplasmic glutaredoxin, thioltransferase, glutathione-dependent disulfide oxidoreductase involved in maintaining redox state of target proteins, also exhibits glutathione peroxidase activity, expression induced in response to stress
Sequence
METNFSFDSNLIVIIIITLFATRIIAKRFLSTPKMVSQETVAHVKDLIGQKEVFVAAKTY
CPYCKATLSTLFQELNVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYINGKHIG
GNSDLETLKKNGKLAEILKPVFQ
Download sequence
Identical sequences A0A0L8VU53 A0A250W839 A6ZZA0 B3LFF7 C7GKU6 E7KMB5 E7LTD6 E7Q2T2 E7QDH5 G2WBP0 H0GEU0 P17695
YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W 4932.YDR513W YDR513W SCRT_00030 YDR513W YDR513W YDR513W YDR513W YDR513W tr|A6ZZA0|A6ZZA0_YEAS7 YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W YDR513W NP_010801.1.97178 YDR513W YDR513W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]