SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL059W from Saccharomyces cerevisiae YJM789

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL059W
Domain Number 1 Region: 33-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.69e-31
Family Thioltransferase 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YPL059W
Sequence length 150
Comment GRX5 ORF Verified Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; mitochondrial matrix protein involved in the synthesis/assembly of iron-sulfur centers; monothiol glutaredoxin subfamily member along with Grx3p and Grx4p
Sequence
MFLPKFNPIRSFSPILRAKTLLRYQNRMYLSTEIRRAIEDAIESAPVVLFMKGTPEFPKC
GFSRATIGLLGNQGVDPAKFAAYNVLEDPELREGIKEFSEWPTIPQLYVNKEFIGGCDVI
TSMARSGELADLLEEAQALVPEEEEETKDR
Download sequence
Identical sequences A0A0L8VFT5 A6ZWI9 B3LL09 C8ZIX1
YPL059W YPL059W tr|A6ZWI9|A6ZWI9_YEAS7 SCRT_02433 YPL059W YPL059W YPL059W YPL059W YPL059W YPL059W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]