SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL181W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL181W
Domain Number 1 Region: 16-135
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.15e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.0061
Further Details:      
 
Domain Number 2 Region: 180-232
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000632
Family UBA domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGL181W
Sequence length 414
Comment GTS1 ORF Verified Arf3p GTPase Activating Protein (GAP) that localizes to endocytic patches; gts1 mutations affect budding, cell size, heat tolerance, sporulation, life span, ultradian rhythms; localizes to nucleus and induces flocculation when overexpressed
Sequence
MRFRSSSHSLKHVDRELKDLINSSENANKCGECGNFYPTWCSVNLGVFLCGRCASVHRKV
FGSRDDDAFSNVKSLSMDRWTREDIDELVSLGGNKGNARFWNPKNVPFPFDGDDDKAIVE
HYIRDKYILGKFRYDEIKPEDFGSRMDDFDGESDRFDERNRSRSRSRSHSFYKGGHDRSD
YGGSRDSFQSSGSRYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYLEKSSSSRNS
VSAAATTSTPPLPRRRATTSGPQPAIFDGTNVITPDFTSNSASFVQAKPAVFDGTLQQYY
DPATGMIYVDQQQYAMAMQQQQQQQQQLAVAQAQAQAQAQAQVQAQAQAQAQAQAQAQAQ
AQAQAQAQAQAQAQAQAQQIQMQQLQMQQQQQAPLSFQQMSQGGNLPQGYFYTQ
Download sequence
Identical sequences YGL181W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]