SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR128W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR128W
Domain Number 1 Region: 12-53
Classification Level Classification E-value
Superfamily UBA-like 0.00000000638
Family TAP-C domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR128W
Sequence length 269
Comment DCN1 ORF Verified Scaffold-type E3 ligase required for cullin neddylation and ubiquitin ligase activation; contains a ubiquitin-binding domain (UBA) for ubiquitin and Nedd8 (Rub1p) interaction and a PONY domain involved in cullin binding and neddylation
Sequence
MSNNKIKRKDASPEQEAIESFTSLTKCDPKVSRKYLQRNHWNINYALNDYYDKEIGTFTD
EVSTVAHPPVYPKELTQVFEHYSNNNLFDIDSLVKFIEELGYNLEDLATLCLAHLLGYKK
LEEPLKREDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYAFNLILDPNRK
DIDTDEGIQYWKLFFQPEYPVRMEPDLLETWFRFLRDEGKTTISKDTWRMLLLFFKRYPT
IQKIISDYDETAAWPFIIDEFYEYLQDQQ
Download sequence
Identical sequences YLR128W YLR128W YLR128W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]