SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR175W from Saccharomyces cerevisiae YPS163

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR175W
Domain Number 1 Region: 16-312
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.58e-52
Family WD40-repeat 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR175W
Sequence length 315
Comment SWD3 ORF Verified Essential subunit of the COMPASS (Set1C) complex, which methylates histone H3 on lysine 4 and is required in transcriptional silencing near telomeres; WD40 beta propeller superfamily member and ortholog of mammalian WDR5
Sequence
MFQFVTPVGTQNGLKATCAKISPDGQFLAITQGLNILIYDINRRTVSQTLVTSHARPFSE
LCWSPDGQCIATASDDFSVEIIHLSYGLLHTFIGHTAPVISLTFNRKGNLLFTSSMDESI
KIWDTLNGSLMKTISAHSEAVVSVDVPMNDSSILSSGSYDGLIRIFDAETGHCLKTLTYD
KDWKRENGVVPISQVKFSENARYLLVKSLDGVVKIWDCIGGCVVRTFQVQPLEKGVLHHS
CGMDFLNPEDGSTPLVISGYENGDIYCWNSDTKSLLQLLDGSLYHHSSPVMSIHCFGNIM
CSLALNGDCCLWRWV
Download sequence
Identical sequences G2W9H7 N1PAU4 P38123
YBR175W YBR175W NP_009734.1.97178 YBR175W YBR175W YBR175W YBR175W YBR175W YBR175W YBR175W 4932.YBR175W YBR175W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]