SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0101660 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TvY486_0101660
Domain Number 1 Region: 50-604
Classification Level Classification E-value
Superfamily SIS domain 3.06e-208
Family Phosphoglucose isomerase, PGI 0.000000000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0101660
Sequence length 607
Comment | organism=Trypanosoma_vivax | product=glucose-6-phosphate isomerase, glycosomal, putative | location=TvY486_01:578201-580024(+) | length=607
Sequence
MDSFLRDLNAHVASSPATQNTKSIAVSSFNAPYEITRRLKTIGTSPDSKLISCESWKQLQ
KLYECHADESILKHFQRDKERFKKYSLKLDLKSKDNNFLFLDYSKTHISDGVRDCLVKLA
EERGVREFMRSLFSGEKVNTTEGRSVLHIALRNRSNRPIFVDGKDVMPEVNRVLDQMRVF
SEKVRNGTWRGQTGKSVRHVVNIGIGGSDLGPVMATEALKPFSKRDIQLHFVSNVDGTHI
SEVLRSVDIETTLFIVASKTFTTQETITNALTARKALMDYLRANGIQEQGAVAKHFVALS
TNTQKVKEFGIDEANMFQFWDWVGGRYSMWSAIGLPIVISIGYDNFVELLTGAHIMDEHF
INTPTEKNIPIILALVGIWYINFFGTPVHAVLPYDQYLWRLPAYLQQLDMESNGKSVTKS
GNVVTTLTGPIIFGEAGTNGQHAFYQLMHQGTTLIPCDFIGAINSQNNVGDHHRIFMSNF
FAQTEALMIGKSSSEVENELRSSGVSCEEKIKALVPHKTFCGGRPSNSLLVNALTPRALG
SIIAMYEHKVLVQGAIWGIDSYDQWGVELGKVLAKSILSQLKPHVEVSNHDSSTNGLINM
FNAFSHL
Download sequence
Identical sequences G0TRF4
psu|TvY486_0101660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]