SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0705620 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TvY486_0705620
Domain Number 1 Region: 290-605,654-697
Classification Level Classification E-value
Superfamily SIS domain 1.81e-74
Family double-SIS domain 0.00000448
Further Details:      
 
Domain Number 2 Region: 2-263
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.8e-49
Family Class II glutamine amidotransferases 0.00000668
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0705620
Sequence length 698
Comment | organism=Trypanosoma_vivax | product=glucosamine-fructose-6-phosphate aminotransferase, putative, (fragment) | location=TvY489_07:1539910-1542788(+) | length=698
Sequence
MCGIFAYINYKIPRTFRDICEILLDGLQRIEYRGYDSAGICVDNPVCETIVLIRNVGNIS
DLRKRVFGDKLGVVTTHAEEVFDVHVGVAHTRWATHGVPSESNSHPQVSNDQSFIVVHNG
IVTNFMPIKQELLEEGYNFTSSTDTEVIAVLAEQIFKKDPTVDLLRIATEIVKKAEGTYA
LLIKSTHFPGELVGCMCGSPLVVGFQQGSEASGGCGGGVPLQEMYFSSDVNSFLPRTNKV
SFLEEGDIVLVRQGFASFYNFKDGAATPVTRAAKTVAYTSEGLSKGQYTSFMLKEIHEQP
ESVTRCMQGRVNMETGLVAFDDLSEDVLAGLRGAECIRLIACGTSLHSCVAARPIFEELL
PDKIIIVENALDLLDRHPNTKPGDACIFVSQSGETADTLAALHHYKKQEVVLVGVSNVPE
STLLRLVDAKILLNVGVEVSVASTKAYTSQIVVLTLVALVLNQGPRGASQTSYGNLEAVK
QRRAEILDGLSLLSTTIATCLNSVDGVIKQLANRWKDIGSLLILGRGYDHATALESALKV
KELSYIFAEGIHAGELKHGSLTLVDEQSFVIVFCSHDRFLERSMNAIQQVRARGGNVVAV
TNAQPSAELLSAGVHCIQVPTIIEVRARGGNVVAVTNAQPSAELLSAGVHCIQVPTIIDC
LQGVVNVVPLQLFAHHLAVIRGLNVDCPRNLAKSVTVE
Download sequence
Identical sequences G0TZ36
psu|TvY486_0705620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]