SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for psu|TvY486_0805920 from Trypanosoma vivax

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  psu|TvY486_0805920
Domain Number 1 Region: 111-328
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 4.05e-18
Family Protein prenylyltransferase 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) psu|TvY486_0805920
Sequence length 394
Comment | organism=Trypanosoma_vivax | product=conserved hypothetical protein, conserved | location=TvY486_08:1697217-1698401(+) | length=394
Sequence
MHALPTFMEIASQLHAALDAAAGRLASGSHVGCSLALLPDVALRGLSHHWGVVELVGQGN
SFQLVVGVGKEILVEAAASILGREHKQEGGMGANNNKLPLIGPVVDCLAHDTTALLLLLF
PAHNSLWNARRRWLTFNVNRDSKNGGHGGSFLLHELLLTSLLVSFHHKMQEVWVHRWWVV
QRLASRNVICAEVFHQHDRAVLLEASDKHRMNYHSWNYRRQAVTFYLLNTQGGSGGSALA
LSSITLLQEEVDTTIRFFETHNGDASAVSYLTFLLKQSQTIDSSCVFVRGMWAKLMTTTS
RELRRHCDKGHEAVWVLRLALVHWAMKVRLACGWTLQDELDFVNLFAELPQWPCAEHVLN
DRVTWEGVQGSWRGTSYYAAWYGSQLVKWLRAPF
Download sequence
Identical sequences G0U1M8
psu|TvY486_0805920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]