SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435847867|ref|YP_007310117.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|435847867|ref|YP_007310117.1|
Domain Number - Region: 13-89
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.00366
Family NADH oxidase/flavin reductase 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|435847867|ref|YP_007310117.1|
Sequence length 185
Comment hypothetical protein Natoc_2563 [Natronococcus occultus SP4]
Sequence
MSDAPAGAVELADRISALLYGIAGWLTVGFGLLLTVAAGRFGYSVATGTARVDAAIAAGL
FALVLLLTGLVTVALGLFVNPRFRRRLDRRHGPSTFGRVRSVDRRVVRPEERCLERCVDC
DDRVEKGLVRRYREEYALAGVPVYTCSEGYNHYCLECTTVGLRAEDVAGSSAEPEPDRRV
LERAK
Download sequence
Identical sequences L0JZ79
WP_015321767.1.9138 gi|435847867|ref|YP_007310117.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]