SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435847936|ref|YP_007310186.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435847936|ref|YP_007310186.1|
Domain Number 1 Region: 99-231
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 1.9e-44
Family CTP-dependent riboflavin kinase-like 0.00015
Further Details:      
 
Domain Number 2 Region: 10-94
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000186
Family MarR-like transcriptional regulators 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435847936|ref|YP_007310186.1|
Sequence length 235
Comment transcriptional regulator of a riboflavin/FAD biosynthetic operon [Natronococcus occultus SP4]
Sequence
MSVTAESAVGHDELAVLKLLALEGGLEGDVKISCSRLAERLDASNQTASRRLQRLESADL
LDRDTVSDGQWVAVTDAGERALHAEYEDYRRIFETDAEVALEGTVTSGMGEGRHYISLPG
YQRQFEDRLGYEPFPGTLNVDLREDSVRRRSALASLEPVPIDGWEDEDRTYGPAVCHPAT
VETADGESYDEAHIIAPERTHHDEDQLEVIAPKKLREALDLEDADHVTVTVGDRR
Download sequence
Identical sequences U3GK75
gi|435847936|ref|YP_007310186.1| WP_015321836.1.9138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]