SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|435848319|ref|YP_007310569.1| from Natronococcus occultus SP4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|435848319|ref|YP_007310569.1|
Domain Number 1 Region: 78-149
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000000073
Family Intron-encoded homing endonucleases 0.013
Further Details:      
 
Weak hits

Sequence:  gi|435848319|ref|YP_007310569.1|
Domain Number - Region: 158-190
Classification Level Classification E-value
Superfamily NOB1 zinc finger-like 0.00131
Family NOB1 zinc finger-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|435848319|ref|YP_007310569.1|
Sequence length 208
Comment hypothetical protein Natoc_3033 [Natronococcus occultus SP4]
Sequence
MPSTRSYSNSRLGGPTDDCEIGIVFRAIVFASKSRVRAGSPMQRAVGCEMSVDCPHCDRA
FDSHRAKSVHASQVHFPRVPATRCDPYGHREIDTKHNGTRHRVQVHRLHATLLVDDIGEL
AEKEVHHVNGCPFDNRLENYELLDTGSHRAKSKETYRNLSGFKVLCRACGTPNQLTKRED
TNFCPTCGSGVEVEEIVRSEPIDWRIPH
Download sequence
Identical sequences L0K368
gi|435848319|ref|YP_007310569.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]