SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|434405229|ref|YP_007148114.1| from Cylindrospermum stagnale PCC 7417

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|434405229|ref|YP_007148114.1|
Domain Number 1 Region: 131-389
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.71e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 2 Region: 465-602
Classification Level Classification E-value
Superfamily TPR-like 3.52e-20
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|434405229|ref|YP_007148114.1|
Sequence length 725
Comment protein kinase family protein [Cylindrospermum stagnale PCC 7417]
Sequence
MEGLRCSRNGCTGTIEDDYCNVCGLAAVKTPVVSQKQSATITGRNSSVTTNTGSSPLTNR
SKGSRRTSSTSARSSRRQLGAGLISVPELPSTEPEKAIIPNPQVPDNKRFCGNCNHPLRR
EKGFCSKCGQKFSFIPSLKRGDLVVGQYEVKGAIAFGGLGWIYLGFDQTLSRYVVLKGLL
NTEDASSAAVAVAERQFLAAVKHSNIVGIYNFVNHNNEGFIVMEYVGGQTLKEIRKSRGP
LPVAEAIAYIHRILSAFAYLHSLGLVYCDFKPDNIMVEGGDVKLIDLGGVRRLDDPDGDI
YGTVGYSAPEAGEGPTIVSDLYTLGRTLAVLLTEIKGFSKEHLYKLPSPQEEPLFAEQES
LYRFLIKATAENADDRFQSADEMADQLLGVLREVVAIATNIPRPYASNLFGGDMLALTNS
GDFELITADYRQLPIPLLDSSDSGFNAVLNASAIADPVKRCVSLEVVVQQYPTSKEAWLR
LANSLIDAGEYNEAEQAIAKVEAKDPWDWRVFWYRGRSLMAQGKLQEAQQTIDQAYFDLP
GEVAPKLALGLAAEQAQNYQLAIKMYDLVSRTDPGYVSASFGLGRCLCATGDRLGAVKAL
ERVPPTSNLFTRSRVEIARSLIDSDRTMPGTQELKAASAAVETLTLEGIDRYRLTKQVLE
TALKLLTSRTLKAAADLKILGQPFEEKPLRCGLEKTLRDMAHLASGNEKIPLVDQANRVR
PRTLF
Download sequence
Identical sequences K9X033
WP_015208683.1.47433 gi|434405229|ref|YP_007148114.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]