SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII60501 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII60501
Domain Number 1 Region: 74-131,225-454
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000139
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.02
Further Details:      
 
Domain Number 2 Region: 890-921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000537
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII60501
Sequence length 968
Comment pep supercontig:ASM82789v1:scaffold02335:33731:40041:1 gene:RF11_05574 transcript:KII60501 gene_biotype:protein_coding transcript_biotype:protein_coding description:VPS10 domain-containing receptor SorCS1
Sequence
MKSLQFILILFVNLQHFVLLVSAYNEDYTYDVPPPELVPRIIYNKLSLQDLQHQVMSNDG
LILILKNFNKKNISATESFFYVSNDYGLTFSRFTPMVDEKPVFVKTKTLYISSDYGQNFD
KITEGVESIKFFTDKPLIFIIHDNDMMQVRDMSNNNAIIFQIHAIQGRILYAPSSLIINF
MNVKNVFYGLAKYEWNLMIYDFETRQSVAVVLPTLFHLKTLDQYDDLHGHYYIVATDLLE
NRCLFTSYDKGSYFVTVMCDLSKKTLNTCPVLIHPFLPGVIYANVRPELKLFHTYYSKND
GKMFGKMKIDYQNRACVNGLGDGQFHLPCVYKPYQFFMKEWIISLAGYYGHYQTDQIHFF
ITFNAGKIWKLVPFSNFPVRIMNEGGIILGLNQSTNKLIYSFDEGNTYYGLSIFDEDQFV
IEVAIIGTAEKERAIFYGHDANRSTLLIAHVDFTKILKRTCIMEDYSPWILTRYHGSCYQ
GQEIIYLKKNMNSTCIDNQTDTEMISKSCPCYLEDFQCRFNYFFKDDYCILDRFSDFKTV
NLKCEPEHRPVTPLNGFTKLARGVCSARVWDSNNAGKKAEVCVSNKYSNSMLFKSMKTLF
RYELDYMGHHLPKFEPEYVPIPPDVNRTLPFFYDLLNDYIYSVSNYTISSYQKHRDEIYR
TELYLLGFNISSLAIDHYMNLSLILDTNSNLFVLCLRTNYAKLLAQNVTDFEYSHNNLSV
SLIKSGQICFYRFYSHIECSKTDLDVQKFVYFDDYHYYALHLKNQTLVIYEGSNISLIST
QEAFVKVEQVETFGIIKYNLFFTKSAQLIRVDLRYPTRFDLVSDHDFSDLKFSIHVIYSE
NPYENFSNGCTFHCNPLIKTEDFCYCKEKEVPQKYVCDGQNSDCLKRYCTGFQCESSECL
KNNVMCNRINDCRDRSDEKGCSKKCPDSHHLCEKDCIPKNILCSSAVYEYHGISYLDEVE
NKNRYRRT
Download sequence
Identical sequences A0A0C2MFL1
KII60501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]