SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII61044 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII61044
Domain Number 1 Region: 54-190
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000107
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII61044
Sequence length 303
Comment pep supercontig:ASM82789v1:scaffold04139:11273:12184:1 gene:RF11_10977 transcript:KII61044 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MFYFHDILYILLFKNEYNLCLYTLNEHDHMVEIICNLSLKYQYDRKSPIMINPHIPGVIY
ANLQINDNNTITVISFDEGKHFLPIELEGNYSGCFDTSCCVEFYLELMIESKEDHFPEKW
MAIFQGVYHCNGSSRYHNFMTFNGGKTWRILDRIIQKFFVLNHGGLVFAIEQSSNIIWYS
YDEGNNWYDDIRGDFKDVFPLESHNNLGISALNVNRAYNIHSFNKYVFSSVISILCLMTD
RTCHNDDYEPWYIPRFYENCFRGEEAFYWKIKRSAMCFDNRTVLIPTFEPCQCIRDGFQW
YSN
Download sequence
Identical sequences A0A0C2M9P6
KII61044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]