SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII61119 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII61119
Domain Number 1 Region: 43-102,140-176
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000105
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII61119
Sequence length 754
Comment pep supercontig:ASM82789v1:scaffold02448:357314:364095:-1 gene:RF11_05838 transcript:KII61119 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MSPKYSWATFEGFEKYDLKYVFWIEAPNYLLIYFRKTNEASDTPNERIYLSKDGGNSFTL
WSPTYNGNPIYIDEFVATKNILFGKSNINRLFFYVDSNLKILSAEPLERNELAIPSLFNP
PYIIKLVLTDITGVKRVFDLYISRNFGKTFEKIDDFVEEASWIFNTSNIIYLTNSTVRIL
DVLNNFKEIYIFFNITRFYPIRNEFILLEYDQSVDKNGKMDILNMGNSRENTIKTLHLRR
SGLRIDSTIVLKFNDYSFDEGRNWHRKRSKANNYIDIISLEYQNYRAIAAIDYNTLTNIY
TLHLFDFSNVIDRMCEIDDFESWYVPRDSGQCFQGQEVAYLRKKPLAVCVDNRSSVIPTI
KPCPCSLEDFHCKSNYYSKDKICIFDPFSNVTESLKTCRDGGIPLNHLNGFVTLDPNFCS
PMSEGLDENSEYAEYCISNDFRIEINIFYADALIECQLDYKGHYLPASSFNNHSLPITIN
DNYPISYDISSKTIYLFYNNMIFRFYENNGSFTDNETSLYRLDFDVVSLTYDYLNSLLFI
LDTNRRLFVISFQTNYIKLLSRDVTAFRYHTNTLAVSFATTDQICYYILYSNINCLDSES
DIKKYVYSPESQFHIWLLHNNTLFVSRHSNVGKTNKYESEDFCYCMDTEGSSKEYVCDEN
DSECLNQLCVGLRCKNGNCRRNNVRSNSIDDCGDLTDETNCDQICHSSEHLCHGVCFSNA
FICDDLTYEYPHVNMNEVSRHRSATDDFTDNNTI
Download sequence
Identical sequences A0A0C2M9Y6
KII61119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]