SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII61149 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII61149
Domain Number 1 Region: 53-215
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000248
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII61149
Sequence length 292
Comment pep supercontig:ASM82789v1:scaffold05642:31983:32884:-1 gene:RF11_16432 transcript:KII61149 gene_biotype:protein_coding transcript_biotype:protein_coding description:VPS10 domain-containing receptor SorCS1
Sequence
MDYIDIHGNYYIVAEDVYQQACLFMSYNKTPYFVTVMSGFSHENLDRTPIIIHPTLPDVI
LLNIHEFGDDFNTYISKNNGKTFDMIKYEDKSKGCNKGLCSAKLNFEGIHLVHDAFTREW
IIKLTSIDDRFQYIVTFDAGETWRVVPFANYHVNILNGGGIIMSIDRTNNKMVYSFDEGK
IYYHMPIFQKDDIIFSSMIIGTADNERLIIYGRNSNNTVLKITYVDFTTLFKKPCQHDDY
SPWSFSRSRGNCYNGQEVVYWKKNVNAMCIDNRTATMKNSKTCPCYLQDFQW
Download sequence
Identical sequences A0A0C2MA05
KII61149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]