SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII61676 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII61676
Domain Number 1 Region: 22-192
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000523
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII61676
Sequence length 503
Comment pep supercontig:ASM82789v1:scaffold02650:1930:3441:-1 gene:RF11_06521 transcript:KII61676 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MLDKYDVFVQIICDLAEYDSATGNCPVVINPHLPGVIYINLKQAGKHSITYTSHDDGKHF
KRLQLEEEHPDCNDNNCGFELDLNCSSGFMANSFPTNWIVKINGIFHKIGSRSNHSFVSF
NGGLSWKMLDTRIEQLTIVNNGGLMVGHERKKGKIWYSYNEGRKWLRVKIKAYNCIDIIP
LSFDKYRVLAVINYKEKTRTYKLSLLKFNRALSMMYLMIGTQCDVNDFDTWYVPRYQGTC
FQGEEMIYLKKKPLPICFDNRTSSLPTINACPCSLEDFHWYSNINDSKTNYFFKDNLCLL
DTNLNLTESSKICLDGGKPLNHLNGYELYLNRFAQLDSDLCYPRETFLIENSNYSDYCIS
VSNIHFISDFSIRIYVIFPDQINECEFDNKGYYLPASFFKKYDLPMTISSIDPITYNING
KEIYLYKNHKIFRYFEELNKFTKDEVSLYQLNFDIVEITHDYINSFIFILDTKHRLFALS
LANNYIKFLTSDVIDFSFDIDTM
Download sequence
Identical sequences A0A0C2MJ75
KII61676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]