SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII62486 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII62486
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000196
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII62486
Sequence length 251
Comment pep supercontig:ASM82789v1:scaffold05546:31939:32694:-1 gene:RF11_16124 transcript:KII62486 gene_biotype:protein_coding transcript_biotype:protein_coding description:VPS10 domain-containing receptor SorCS3
Sequence
MNDTQSKTSISFDNGKHFQVIKVEPNSSIYYENACVAEFELDCQQDLTTKYFHKPWVVKF
HGIYHCRYSHRRHLFVSFNGGLTWKIFQQFSEDFIFLNHGSLILARQYMSESLWYSYDEG
NHWYNDSYADVFKIKKIASINTLVASVVLYNKIDYIYTILNYDFSSIISICYITIDRTCQ
RDDYEIWYVPRYNDNCFDGEEVSYFKIKPSSMCLDKRTVIIPNISTCKYVDQDYRNNRHL
PLGIAEEQERA
Download sequence
Identical sequences A0A0C2MLJ2
KII62486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]