SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII63005 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII63005
Domain Number 1 Region: 51-202
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000165
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII63005
Sequence length 261
Comment pep supercontig:ASM82789v1:scaffold00208-2:29946:30731:-1 gene:RF11_00435 transcript:KII63005 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MIVHNYGTYFYAHGNFYFIVLKNNATLCLCTFDTNDQLNELVCELSIDDWKNDRCPFVID
PYSPGVIYANLNLKNGMTRAHISFDNGQNFRPIEIEGHNTKCILKNCVFELELRCSNDFL
KNSFQKKSIVKFRGRDQNWKHHLRYDTFVSLNGGETWKKIYLEIERLTIANNGGLFFGKG
GFTGQIMYSFDQGINWHNERIVLNNIIGIIPIETPKNQRFAVVDYNQGEFVYTFFIFDFS
KAKSNFYLMIENSPVSKRHTL
Download sequence
Identical sequences A0A0C2M7P3
KII63005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]