SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII63539 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII63539
Domain Number 1 Region: 51-132
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.0000000589
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII63539
Sequence length 263
Comment pep supercontig:ASM82789v1:scaffold05633:58437:59228:-1 gene:RF11_16346 transcript:KII63539 gene_biotype:protein_coding transcript_biotype:protein_coding description:Sortilin
Sequence
MGFKDGESDCGNKKSGVEWDFKCSDDLITNTFPEKWIVKFEGKYHGKCLINRRTFVSFDG
GKRWKMLNSKVENLTIFKSSGFMLGTEKEPGRIWYSYDEGWTWYKKYVFAQNFIYITSLE
SPNSNVIAAINYKESKNIYTFFTFDFSSILSSLFWMIDRECTEEDFEIWYVYRNFGNCFQ
GSEISYLKKNAMVICTDKRSQIMATIKPCPCSLEDFHWYHNFYHSKPNYYSQENLCVFET
YSSFSLPVKACRDDGTALNKLDG
Download sequence
Identical sequences A0A0C2MGS6
KII63539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]