SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII64014 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII64014
Domain Number 1 Region: 706-744
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 742-782
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000353
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 623-658
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 666-705
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 35-179
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000194
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.017
Further Details:      
 
Domain Number 6 Region: 830-865
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000432
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 7 Region: 870-903
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000223
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 8 Region: 793-824
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000798
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII64014
Sequence length 1155
Comment pep supercontig:ASM82789v1:scaffold05189:7934:11917:-1 gene:RF11_14636 transcript:KII64014 gene_biotype:protein_coding transcript_biotype:protein_coding description:Sortilin-related receptor
Sequence
MRLSRLKVQDRFENEFKACHNLELFQHIPGMIYSRIYMHKFSYKSKISKNSGRTWEDIDY
NPRKCPKECINEGLGSFYIECVLVISDHCKFPTKSRFLTHETAPNLLLAYGFLKIGKDRV
EGLFISEDFGSSWYTGKRLLKHFTMLDQGGIIVGIENDGTICYSLDNGLEWIKTNIGEDL
ANIDIFSFEQNSLKQVLIVAQSKKNNSWILIVLDLSNIFDRECNIDDYLIIPHQTGSRRC
FNGLTKTAFKRKVKSACFNTMDHLLHRPNESRCMCTEDDLKCNFGFSMVDGGCEPDPDYF
KIQTKCKYGDYVPKSDTVFTFMNQSGIFYKSLNIAGYGKLIDLYSTISQVISYDINTHKR
DLFIATHDGIYRINYGHPNFWNGQNMSKILNVEGIRQIAWDPAGYTLYFSVDKELRSFNP
DDLAIRTLKTTYVIETFSILPDIGLLVYSEKVMGQLEGLYIVNIREIGGNHVHNFTTDQL
FHTAHFFSSSKELMIHFQKSTHLFENIFNPEARSSSKIIENNMAGSDIVRSYKWNGQDLV
LTKNQVLYKNMVVVESSTIVDGRLHISYKLLNKICLSAQCSHFCSVHNQTYRCSCPDNMK
LHNEFDCVNDLAASCYSVIHLGDSDDMFKCESGECIPISKKCNGFADCVDWSDEVGCQKS
KCKHYEECPSNQFLCDDGTACIDISFVCNGKKECPDSSDEKYCQYTLKCKSNEFKCHNLK
CISTFKVCDGTDDCGDASDEQYCKISKCKFDQLSCDNQTCVGLSQFCDGHFDCLDNSDEA
NCKKYDLADKGCDFKCDNKCLDGSKLCDGYVDCEDESDEVNCIINYECPHATMLKCRTGH
QCYKKEHKCDGFRDCLDGSDEYKCPFVGKCDLDYHFNCNDGTCVEINDYCNGIKDCRNGN
DEPVSCATSPLIINFFHNFSRGSSLQLEWNGNRLDSNEFYHISLIDLDTNQAIIDDYRYE
NRQLTVPHIEICHRYIAAVTLAGTMTGRVIQFTARNEEIKPPKHLNFFYRSNKLSWKYPG
KLCIPVTYFVFCYRKNILVFRRFMFENSAILTSEVDSCQIATCPKSVFNISCSKYATIQF
EYNRSYKYLVALGVNLPFILFFIFLLVFVWLYFKNALVSIKNNISKFILFTTNRYRRRFK
RRRKFDLALSQLDQV
Download sequence
Identical sequences A0A0C2IF98
KII64014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]