SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII64382 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII64382
Domain Number 1 Region: 97-241
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000732
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII64382
Sequence length 344
Comment pep supercontig:ASM82789v1:scaffold03278:16068:17102:-1 gene:RF11_08348 transcript:KII64382 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MKKNIIIGISGLETSNVITKTFNLNVFGGRPDLSILWNYKQFFYLHGDFYFLVQRNASSL
CLFSLNKYDDLIQQFCYLKKYEESDNKCPIIINPHLNGVIYANFKTDDSKTRTKVSFDNG
KTFNPLVLEGQSVSSLKYDSWIELDFICSMELQNHNFQEAWIVKFDGTYHRKGLSSHHTF
ISLNGGKSWKMLHAQIDNFIVLNHGGLIFGSEIGTSNIKFSFNEGINWNTKNIWAKKVIG
IKPLQFPDNLAIAAIHYKEDTHTYYLFIYNFSSIFSILSLIIEQICKITDFKAWHVPRYF
QNCFQGQQISYLKKKSQLICMDNRTIIQQDIKTCPCFLLDFPWY
Download sequence
Identical sequences A0A0C2MRK3
KII64382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]