SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII65641 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII65641
Domain Number 1 Region: 903-939
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000838
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 2 Region: 300-434
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000379
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII65641
Sequence length 1041
Comment pep supercontig:ASM82789v1:scaffold04998:254953:260307:1 gene:RF11_14270 transcript:KII65641 gene_biotype:protein_coding transcript_biotype:protein_coding description:Low-density lipoprotein receptor-related protein 5
Sequence
MKKAHLPLIRDNTFHDESDSFEVIQNLYLPHFILYFAKNSQVGGKSALYKYDESQSTFQL
ITLKPSRDIANISKVVPAGKKMFCLYTWGNHAFYINEMLEVEHEQKLFPGYEYFPNPDYP
DFIAERPVNTSSKEYHMAFSVNYGEHYTTYFMMFKKFDWVPQSKDVIFTSTGKKLTITNM
DNHETSLKLTDVEDYMIAENQILIIQSTQNVKQLNLSIYDAEKRKLSSTHFPALLKIHQV
KLFDYVFGNHYLVLVDDNSNTCLWSPTDTPLYFVRKACYRTDANIKTEPDFYISKIVEGV
LYWNHLNEKNELQTYRSSNNGRSWFDVKFELPDKSTYNKTFYFDFKLRERHVVPTDHFWI
DIQFAKINDAFRTCITQNNGYSWTHLPMDASNVIFLNSGTVIVSVVPEYRIVIYSLDGAK
TWINHRIYGTDIHLEYVGKFVGDDLKALVVARDSRTNKLYFKILDFSNIFTSACKSEEYL
QWPLHRSHGFCYQGTILLIKTRDPTNIKQLRLNARVQEMILTGQPFSKRSRFNYFSLDDL
CVLDPNSDKTEEPYKCDSGSHFSSSHAGYVKIPYDKCNPSELNPDAIDTLNDLCVPNEYT
DFLVLKAPNKIYVSQLPSHGGYFRKQIKTELFPNKKEHVELPIAFDYTKQLIYNFHNKYL
RKYSYVKREKTDLYYLEDAWIDIVYDSVLHVMIFLTTRMQLKIVSLLTNYQHLVSNNVKS
FRYESYHAFISFVMSSNAICYSNLFDPPICIKSTLNIIQTYIDFYNKRVYMLSENHDLII
KKFENDITNLQDFSEIPKVSLFVVYDDHLYFVTENQLSYRNLAKNNRTMVLIKDVQFTAL
SLHHESLQSFKHECENLNCQFMCFPASVSEVKCGCPPNSVQIDNICECPKDNIGCLCFYF
VKLASHCAGFPCKNSKCLINNVQCNGVDDCGDGSDEIGCKHKCPKDKHMCGRNCITKDIV
CNSIHISEVHIGHKGRKLIGFYIFLIFMTCLTILYPLFLFIRWCYRRLYWRYIRLRLRRH
AYGIELSRLLEEENELYPSFT
Download sequence
Identical sequences A0A0C2MEV8
KII65641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]