SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII66813 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII66813
Domain Number 1 Region: 306-457
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000256
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII66813
Sequence length 851
Comment pep supercontig:ASM82789v1:scaffold01071:105531:109602:1 gene:RF11_02862 transcript:KII66813 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MTSWLITSISTPTNPLTAQNPLTFFDEELEGVAEKLQVVRNDHLPDIIIFYTKQDETTQN
AAVYTYKKTVHSFEAITFSTQKSITGLDSITPTGNKFFCTSFLVSVGFFFNENFEVQNEE
TIIPRYQYLWHPDFPHLGLRYRCNRKDSVCKGDEKKSNEEGYKANWHTFRKIDYISKLPI
CITLTRTSLSVEDFREGFRGVFVRLATDYIMIKDKVLVIYSNDTKYLSLTIVDLFTETQA
PAKFPKLLNIKEVKQFDYAFGNYYLLLVDSSLTTCLWTTTATPYHFVRSACYNTAVNTLM
ESKFFLDKRTDGLLYMNFPINQKEHWTLRSTNRGRSWHEMKFFNTDAWKYSQRVHFKFSL
HDSLNIPDNSESIDIHYHPLTDGLQPFITFDGGYTWRAVPETASKVILLNYRSVIISIDR
DTNYINYSLNHAKSWSRLKLFESKPKVFYVVKLSNDDQKVLIVASGSNPQKIRFKGIDFS
NLINRDCENSEYKDWYLPKSGSGGFCYRNEKILMTIRNSEIRCLDKKTDHIKQKFPCTCS
SDDFPCTFGYRPYSAICVPEALSGQIHEPKKCDAETSDQRHHPGYVKLAETTCTPDISYS
DALKLSQMCVNDEWTNILILHTKYKMYMLRILTPVSDIGEKEPSPIELQENVNINTPIAF
DFQRQLLYNYHDQHIRQFKFFGTSEARIYFHSDPITDMVFDSISRVLIFLTSKRQLKMLS
FLTNFRHVIHEDVVWFKYSFPHRLISFVTSRKSICHWDFLEPPKCATQNLDIKQAFIDLK
KTMTFVLTSQRVLKIKNSVTDFTAQSSLNINDVSNFAVYGDHILNRRSMRVVITSDIETR
PREESEPATIP
Download sequence
Identical sequences A0A0C2JCB6
KII66813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]