SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII67089 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII67089
Domain Number 1 Region: 149-280
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000068
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.027
Further Details:      
 
Domain Number 2 Region: 744-775
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000621
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII67089
Sequence length 880
Comment pep supercontig:ASM82789v1:scaffold00451:270561:273527:-1 gene:RF11_00995 transcript:KII67089 gene_biotype:protein_coding transcript_biotype:protein_coding description:Sortilin-related receptor
Sequence
MDFVSNIRGYVYLSPDKTFHFFDGRVRSISFTKETVLDYRIVGYQVLLIQPVKDVSDIKL
SIYNCVKKHESWTVFPTLLSIKEVKLFEYDSPYYYLVLVHGDMNTCLWTTTATPFHFVRT
VCSNRETESLVESNIFIDKRDPSQLYFNVLLEKDRKQTYRSINSGRFWHEMKFLKDESSE
YRQAINFNFSLHDAGSNPRGYSEIDIQYQQLPDGLQPFITFDRGDSWKRTPKTQHNVIML
NYATVILGIDMDTNFINYSFNEGKTWIRHKIFTNKLIVLYVGQFQGTDQKALIVTKEAGT
KDITFTIIDFLSILNNDCTSTELHTWHLPSPAGFCQWGLIGIMKTRKPEILCLYKMKSHE
YEGIGCNCTSNDFPCVFGFQPFADICVGDLLSGSYQSPKMCRNGSDDRDHELGYVKVDEK
KCVFHQFYNDISTLSTEFCVKNNNTDFIVLESSHKLYMSRIYKRGADIRKRRPIPIGPFL
KESINGPYAFDFLEQMMYRFKDKRVTKNSFFGVYQASIYFVNDDIIDMIIDPAASVLIYL
TKRKRLMILSLLTNFQDLIYKDVVAFKHSPHQRSLSFVTSKNTVCYSNLTGKPRCHKLNH
DVSHAYVDVEKSKIYSITPDRVLKIQTYAKDFSDMKMYLEILNVQDFAVVDDNLYFLSDG
NMMYRNMTSDSTKVLLVHQHNFDHLVFHRVYFQNQQLCKKFNCQFMCYPDSYSSASCGCP
SSMIKDKNICKCPPKIPDCLRQYCAGYLCKNSKCLPDNVKNNGVDDCGDNSDENHGHIKC
SSHNHLCHGKCITKDVVCGNDKEDTPKQSKLRRFPTILIICVCLIIGISITITIYKIIRT
TRQKRIHRRMKLIIYDDLADLENTDATEYNDVISLDEEQG
Download sequence
Identical sequences A0A0C2INM4
KII67089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]