SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII67504 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII67504
Domain Number 1 Region: 108-251
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000392
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.034
Further Details:      
 
Domain Number 2 Region: 694-728
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) KII67504
Sequence length 778
Comment pep supercontig:ASM82789v1:scaffold00664-2:10801:13450:-1 gene:RF11_01660 transcript:KII67504 gene_biotype:protein_coding transcript_biotype:protein_coding description:Sortilin-related receptor
Sequence
MSSKPRISDYRKVEDKILLIQPLESENDFKLSIYDCQTKMARACLFPLLLKIKEVKLFDY
DKDIYHVILVHEDLNTCLWTTTETPLHFGRTVCTNTQIKSDMESSFFLDRSRNSQIFLNF
RTQTNQQKTLRSTNKGRTWNEITILNPNKFKYDEPVHFIFSRHDPRNVPETFTEGDIQYQ
VLKDGLQPFITYDKGNSWTAAPKTRSNIILLNYGMVLLSIDKDTDYINYSFDYANTWIRH
KVFNLKPKVLYIGRLTETDQKALIIIKMSLTNLIKFSIIDFSKYFELDCTDEQYQLWDLP
TSDGFCHHGTIVEMTTRIPDNLCVDKKDMHISFESICSCTPDYFGCTYGYQPFSDLCVPD
SLFGNLQQTFKCKYESYHNIEDQRGFIKIQKNICLPHIDYRNKNQISSEFCGNYDHTNFL
LLYSSTHLYISRVLTYSTDVMIKRPISMDIYLNPTMGKPFAFDFPGQIIYSYNDKRITKY
PFFGTLQQSIYYLNDDVMAMVYDPLTHVLVYLTRKNRLKLLSTITNFQQIFYEEVVTFKY
IPYQRYISFVTYTNYVCYSDLREKPICYRPHFNVLQAYVDREQYTMYLLTSLHVLEIVTF
VNNITDIKLLTKIPDVDDFTVFKNNLYYLTQGNLMHMKMGNLFERFLIDANHHFTHLVFH
RVYLQIIKCGCPGNMIQYNNECICPENSPNCLANSCAGFFCDNSICLPDNVKCNGSNDCG
DNSDEINCSHKCTENNHLCLGSCMSKDIVCGDDHIMDTPKDQKFSLTHISMFFCKYDK
Download sequence
Identical sequences A0A0C2IPU3
KII67504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]