SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII68761 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII68761
Domain Number 1 Region: 4-49,252-304
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000392
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII68761
Sequence length 382
Comment pep supercontig:ASM82789v1:scaffold04425:53296:54485:1 gene:RF11_12035 transcript:KII68761 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MIQIDCSLLYISGDYGQTFNEISECLKSMSYVDDKPWIVVVYLNDWIQIVDMSDSHSPIF
NVESIDGWIIEAPTSMLVKYKKVSNKTGGLEESEWNLMILDYESKRKVEVILPNLFRISN
VEQYNDVHRHYYIVVTDIDGARCLFTSIKTSYFVRVVCYLHNSEDECYIMIHPTLPGVIL
SNLYYKNHYLKTYISMNNRKSFDIIKYKDKNGNSVDSLFEHKLKLECKHSNMEYFPNEWM
IKLKTLGDKLTHFLTFDGGKNWRIIPFLSLWVKTLNGGGIIVGFDTKTNEMVYSFDEGIT
YYHISIFEQDDIILDTQIIGVAENQRLVVFGRKSNMSQLIIAVVDFINIFSSYIYNDRAA
MPNWRLFYMEHVKIKSKLLSRS
Download sequence
Identical sequences A0A0C2MNG0
KII68761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]