SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII70411 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII70411
Domain Number 1 Region: 21-202
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.000000000405
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII70411
Sequence length 247
Comment pep supercontig:ASM82789v1:scaffold03704-1:33809:34950:-1 gene:RF11_09673 transcript:KII70411 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MIKELLIYKIVHNFVDIHGHFYIEVSNIKGVNCLFVSHDRSENFVRLTCDLESKTPPDTS
VAFHPLVPGIIYANLKKGKRTYTHISMNYGKNFSAMKLEKKNGLCDGGYCNIKLNLPSVI
QRNLYFQSKWISAFDIVDYSTGKVIERYLISFDGGQNWKLVPFSYFHVQALNQGGIVFGF
DPKTKKIVYSFDEGKTYYHKTIYGSNEFGLTSTHTGKFENSRYIILARDKLNNDLLITRI
DFPHIFS
Download sequence
Identical sequences A0A0C2MSZ3
KII70411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]