SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII70451 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII70451
Domain Number 1 Region: 66-191
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000432
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII70451
Sequence length 293
Comment pep supercontig:ASM82789v1:scaffold00082:1149:2137:1 gene:RF11_00264 transcript:KII70451 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MAEMKDLNFAKISARIFGKDTTYSVDSGQVAKFEYFVSVDDQLPGTIYISQMITFKNALV
DFDKLSAVSYNYGKSFIPLRYMKSQKQIGWSSCKMFIPPHGDSLKEAIQTAQHNPLLMVA
KIVIKQKDENASSKFMVSNDAGYTWKDNAAEFEEMKISNEGEVILGKNSKLSFTTNQGGS
WEDLNLGINGHKLKYLIVGEKAAKYKFFTLIYSEEWPDVGFAVVDFTKLFQQKCKPTDYK
VVTPGVGRMHSCFNGGKNFLYSKKSHDLCEGSIHSLPKIQPVPCNCTQMDYKW
Download sequence
Identical sequences A0A0C2MT20
KII70451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]