SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII71654 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII71654
Domain Number 1 Region: 65-244
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000379
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) KII71654
Sequence length 384
Comment pep supercontig:ASM82789v1:scaffold00864:74207:77327:-1 gene:RF11_02406 transcript:KII71654 gene_biotype:protein_coding transcript_biotype:protein_coding description:hypothetical protein
Sequence
MNFLVGSQYIERDVDTITVKKVKEVSTSNNNLYAKCDISILPGSKSLSDVIKYSSTNPLI
IVAPCTINIDSMEHETRLMISDDGGMRWSYTQIHFNSIEILNEGEMLVGVEQNTYLHVSV
DTGLTWQKLNLANPDDKILDIIADTGFKYKIVIIGKNGTSHEPQKFESIDDKCYAKDNTV
WGYYENICNQTNELVKSAFPAKKFYENKCVNDYTEDEELEICQYQFNYNTISLLAKNKLY
FYTIYSQIEKIQEFPKELQFKERIYDVKVDKYQKCISLHVKKGIMKKCYYSNKELEMQYE
LVLVHSNIHGMGIDPRNGHLYFHDKNSISVFHAILFIRMTIYTTNNLIYYLKLNVDTDHL
YVSYIEMETGKFVVVILTTSGDLR
Download sequence
Identical sequences A0A0C2J1G5
KII71654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]