SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII72857 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII72857
Domain Number 1 Region: 59-212
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000133
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII72857
Sequence length 394
Comment pep supercontig:ASM82789v1:scaffold05430:155679:156884:1 gene:RF11_15517 transcript:KII72857 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MRGVLPSLERYNEYFYYNGHHYFLAGNSESLCLCTFSRYRQVLKLTCNLQKYTKDNGKCS
FVVNPHLPYVIYANIKKNKQKTRTYVSFDNGKRFIQIKLRSKRHIILKKNYGVELDLECS
DLFINKHFPEKWVAMFRGKLFRKGLVSRHIFITFDGGMHWEMLKSRMEKIIVLNRGGLLF
ERGKKTHLLYYSFNQGAASYKIDIYTSYITSIRPLDFSYTRVVAAINYDKFFNIYTLLLF
DFSNMISICDLMIDRTCTSDDFETVYVPRYHFNCFQGEEISYLKKKRSAFCFDNRTEVQP
TIKPCPCSLEDFHCKKNYVFEDAFCKLDPDSNFTELNKTCRDGGIPLIRWNGYDVITHSF
AQLDSQLCSPRPIIMDRNSKYADYCISTSNMNVY
Download sequence
Identical sequences A0A0C2NFQ8
KII72857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]