SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for KII72859 from Thelohanellus kitauei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  KII72859
Domain Number 1 Region: 131-272
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000000575
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) KII72859
Sequence length 377
Comment pep supercontig:ASM82789v1:scaffold05430:166868:168001:1 gene:RF11_15519 transcript:KII72859 gene_biotype:protein_coding transcript_biotype:protein_coding description:Vacuolar protein sorting/targeting protein 10
Sequence
MEINAFYNIKRFVRIRNDSLLLEYDQVKCFQNQLSETDSRIGILNLENRLGNTIRIIHLR
RSEMSGVLSSLKRYREYFYYHGNHYLLTGNSSSLCLCTINRCDEFVKLVCNLSKYTRLDG
KCSFVVNPHLPGVIYANIQRSKDKTRTYVSFDNGKKFIPIKFKSKSFKILKNNCGVELEL
ECTDLFINKHFPEKWVAIFNGKFHGRGFVSRHVFISFDGGKNWEMLKSRLDKLIVLNRGG
LLFGRGSITHGIYYSFNQGVISYKHYVSTDHLTAIQPLDFPKTSVVAAINYDKFNNTYTL
LMFNFSNVISICDIIIDRTCQSDDFETVYVPRYHWNCFQGQKISYLKQKPSSLCFDNRTE
VQPTIKPCPCSLEDFHW
Download sequence
Identical sequences A0A0C2J4U7
KII72859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]